DesignloungeDesignloungeDesignlounge
0
0€0,00

Couple hoodie with name set of 2 | LOVELY

€69,90

Tax included. Shipping calculated at checkout.
kalles saleDHL Hoursminutes
  • Kostenloser Versand
  • Lieferzeit: 3-4 Tage Werktage
  • Kauf auf Rechnung (inkl. Käuferschutz)
  • Bezahl nach 30 Tagen mit Klarna
  • Hergestellt in Deutschland

Color: White

  • White
  • Black
Will not ship until [19041994]
Out of stock

Pay securely with

immediatelyklarnavisapaypalapple payamazon payments

2 x personalized partner hoodies with desired text under the given motifs.

The motif is available in different colors.

The loose cut makes this hoodie an ultra-comfortable companion in your free time. A solid combination of durability and soft quality.
  • High-quality workmanship: double stitching on the hems
  • Straight cut
  • Soft fabric quality: 280 g/m²
  • Drawstring in hood
  • Knit cuffs
  • Pre-shrunk

Material: 50% cotton | 50% polyester

Fit: regular fit

Care instructions: washable at 40°C, suitable for tumble drying, ironing allowed

Welche Größe brauche ich?

Unsere Hoodies & Shirts fallen optimal aus. Daher empfehlen wir deine gewohnte Größe. Ansonsten haben wir auf allen Produktseiten eine Größentabelle.

Wieso ändert sich nichts auf dem Foto wenn ich mein Namen eintippe?

Mach dir keine Sorgen, das ändert sich nicht. Dein Wunschname bzw. Datum wird genau so aussehen wie auf den Produktfotos. Es ist für uns wichtig, was du in den Feldern eigetragen hast.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist